Apply indoor or outdoors according to label instructions. See how you can save money on pest control! - Pecan If you see spots of brown grass and birds pecking at your lawn, you could be facing a cutworm infestation. You can contact us if you need further assistance. Hold sprayer 12 inches from surfaces being sprayed. Spiders live on bugs, but not enough to be considered for pest control. • Non‐staining, odor‐free and dries fast - Alfalfa How to Use the Ortho Max Ready-To-Spray. Create a bug barrier for up to 12 months (applies to ants, … M. Momma_AM ... I’m 24 weeks pregnant and had to spray some ortho home defense around our home (not inside) due to bad bad bug infestations and problems where we live. - Buckhorn - PearSAWFLIES If you’re a fan of essential oils, you can also spray the areas where spiders commonly hide with Ortho® Home Defense® Crawling Bug Killer with Essential Oils, made with cinnamon, clove, … I bought Ortho Home Defense Max and some lemon-scented wipes (which are actually cleaning wipes) but I wanted to know if it's safe to spray the Ortho inside my car, inside the air vents and near the doors. KILLS: ADELGIDS - Painted Lady Adult chinch bugs are about one-fifth of an inch long and black with white wings folded over their backs. - Pecan Leaf Idk about home spray you can buy but I'm sure there is a number on the bottle you can call. away from you. 2 of 4 … - San JoseSCORPIONSSILVERFISHSOWBUGSSPIDERS - Greenbug - American Plum For more help, visit our Help Center. Apply a 4 inch band along the interior of your home in areas where insects are a recurring problem. Do not use on vegetables and fruit trees not listed on product label. - Eastern SprucegallANTS Simply spray Ortho Home Defense around the perimeter of your home foundation to protect your home for up to 12 months. - Pharaoh/Sugar Report as Inappropriate. I was going to take out all the food and move it somewhere else and spray this Ortho. Garages. Kills 130+ other insects including stink bugs, beetles, earwigs, fleas, house centipedes, millipedes, scorpions, silverfish, and ticks. Ortho Home defense: From the Ortho site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin. Ortho Home defense spray (insecticide) says on the label that it is safe for pets and children once the spray is dry. Sod webworms are the larvae of lawn moths. The pictures on the instructions say to spray it on the bottom cabinets near the floor but these ants are up top. I've already wiped down the air vents and dashboard with the lemon scented wipes but I want to put the spray … Ortho Heavy Duty Sprayer won't spray. - Rose - European Red - Pickleworm This spray kills even the toughest bed bugs (pyrethroid-resistant bed bugs) and their eggs. Visit the post for more. This can be used to spot treat the soil of the plant but should not come in contact with the plant itself. Is it really safe for cats and dogs? Ortho Home Defense. Spray until slightly wet, without soaking. - Black Cherry Turn off water. - Pea 4. - Squash Vine - Carpet Ortho offers several types of its Max weed killers and insecticides in ready-to-spray formulations. ft. *Applies to ants, fleas, spiders (excluding black widow) and American dog ticks. - KudzuSTORED PRODUCT PESTSTHRIPSTICKSTERMITESWASPSWHITEFLIESYELLOWJACKETS. Thank you for inquiring about Ortho Home Defense Insect Killer For Indoor and Perimeter. - WolfSPITTLEBUGS - Tent - Earwigs Kills carpenter ants, foraging fire ants, lawn ants, Argentine ants, pavement ants, pharaoh ants, pyramid ants, and red/western harvester ants. - Carmine Safety Data Sheets can be found at scottsmsds.com. - European Pine With this convenient spray, you can have peace of mind that the insects will not return for up to one year. Don't just kill bugs; create a bug barrier with Ortho® Home Defense® Insect Killer For Indoor & Perimeter2 with Comfort Wand®. Start creating a bug barrier in minutes and enjoy 3 months of protection*. Your home and yard are places for your family and pets to enjoy. Connect sprayer to hose. Ortho Home Defense Max is a bed bud spray that kills bed bugs on contact. - Blueberry Spanworm Use with confidence in kitchens, bathrooms and throughout the house to kill common indoor pests, with no staining or odors. - HouseFUNGUS GNATSGRASSHOPPERSHORNETSLACE BUGSLEAFFOOTED BUGS - Euonymus - Black Widow As a general rule, most products you can buy on a shelf to treat bed bugs aren’t very effective. - Pecan Nut Casebearer - Lady Beetles (including Asian Lady Beetle Eggs) Hi.. - Cat I am having a terrible time with sugar ants and just sprayed Or tho home defense max spray. At dusk, you might even see the worms themselves. People and pets may enter treated areas after spray has dried. - Argentine bottle treats up to 5,300 sq. Now i am wondering if i should try to mop it up, or if it is truly okay for my pets. - Mexican Bean - Apple Roses and other ornamentals; Listed vegetables and fruit trees (see label); Trees and shrubs; Lawns; Around house foundations, porches, patios and stored lumber. - Foraging Fire Ants This insect spray kills and prevents ants, roaches and spiders indoors on … Use with confidence in bathroom, kitchens, family rooms, pantries, attics, garages, basements, closets, storage areas, and bedrooms. - Green Fruitworm Apply as a perimeter treatment along foundations. They are reddish-brown, wingless insects that are laterally compressed, so they look as if they are walking on the edge. • Kills all common listed household bugs (refer to product label for Ortho Home defense spray (insecticide) says on the label that it is safe for pets and children once the spray is dry. - Two Spotted Spider (Eggs) MOLE CRICKETSMOSQUITOESMOTHS - Hobo 4. Can you mop and wipe counters down after using ortho max home defense spray? Never place unused product down any indoor (including toilet) or outdoor (including sewer) drain. Kills 235 listed insects including: Ants, Aphids, Bagworms, Bees, Caterpillars, Chinch Bugs, Cutworms, Earwigs, Fleas, Flies, Grasshoppers, Hornets, Japanese Beetles, Lawn Moths/Sod Webworms, Millipedes, Mole Crickets, Mosquitoes, Scorpions, Spiders, Stink Bugs, Ticks, Whiteflies. Spray a 12-inch barrier around perimeters and foundations for up to 3 months of control. - VariegatedMEALYBUGSMIDGESMILLIPEDESMITES - Corn Earworm Spray a 12-inch barrier around garage door entrances and walls for up to 3 months of control. Ortho Home Defense Insect Killer for Lawn & Landscape - Common Insects Treated, Ortho Home Defense Insect Killer for Lawn & Landscape - Areas of Use, Kills bugs outside before they come inside, 3-month protection* *Applies to ants, fleas, spiders (excluding black widow) and American dog ticks, Common Outdoor Bugs and How to Deal with Them, Controlling Pests on Flowers, Roses & Ornamental Plants. Ortho Home Defense Max Bed Bug, Flea and Tick Killer - With Ready-to-Use Comfort Wand, Kills Bed Bugs and Bed Bug Eggs, Bed Bug Spray Also Kills Fleas and Ticks, 1 gal. - Pecan StemPILLBUGS & ROLLIE POLLIESPLANT BUGS - Cherry Fruit We can … Do not allow this product to contact water supplies. - Red/Western HarvesterAPHIDS Apply a 4-inch barrier around baseboards, cabinets, and windows. - StalkBOXELDER BUGSBRISTLETAILSCATERPILLARS - Peach Twig They have 4 pairs of legs and no antennae. Connect: Shake well before using. - Brown Soft product, or allow it to drift, to blooming plants if bees are visiting the treatment area. - Crickets Do not apply this product in or on electrical equipment due to the possibility of shock hazard. It kills insects, including fleas, ticks, spiders and more, outside the home before they can … You can generally spray it on carpet, but it's better to try to hit the baseboards. World rights reserved. - Southwestern Corn They lie in wait for a passing deer, pet, or person to walk near the shrub or grass they are perched on. You can contact us if you need further assistance. - Filbertworm I bought Ortho Home Defense insect killer indoor and perimeter. Try blowing the path out backwards with the tip removed if you can. - Asian They are a nuisance, largely because of the annoyance caused by their presence - constructing mounds in the lawn or invading the home from the yard in search of food. M. Momma_AM ... I’m 24 weeks pregnant and had to spray some ortho home defense around our home … Product comes in a nonrefillable container. Each 32 oz. However retrement is recommeded at least once per season outdoors. Ants are common pests throughout the world. Simply spray Ortho Home Defense around the perimeter of your home … Top 5 Best Electronic Pest Repeller Control Devices 2020 Ortho home defense max 1 33 gal perimeter and indoor insect ortho home defense insect for indoor perimeter2 ortho home defense insect granules indoor control ortho home defense … - Clover - GypsyPERIODICAL CICADAPHYLLOXERA Adult fleas are no larger than 1/8 inch long. Most often it is a matter of debris having gotten into the tip and you need some thin wire to feel for it and clean it out. - FirebratsFLEAS Although ticks are commonly thought of as insects, they are actually arachnids like spiders and mites. - Striped Cucumber Weevils (Annual Bluegrass & Black Vine) BORERS - Rindworm - WalnutBEESBEETLES Do not spray into air. - Lesser Peachtree Do not apply directly to water. Kills American cockroaches, palmetto bugs, water bugs, Asian cockroaches, and German cockroaches. For best results and a healthy environment, please follow instructions for appropriate usage, storage and disposal. © 2020 The Scotts Company LLC. - Hornworms (Tobacco & Tomato) It is pet-safe once dry, so just make sure to keep pets and children out until the spray … Up to 12-month protection (against ants, roaches and spiders … With Ortho® Home Defense® Insect Killer for Lawn & Landscape Ready-To-Spray, you can kill bugs outside before they come inside. World rights reserved. - Sod Webworms Start creating a bug barrier in minutes and enjoy 3 months … © 2020 The Scotts Company LLC. 4.4 out of 5 stars … Kill Roaches, Ants and Spiders By Contact, Create a 12-Month Barrier for Ants, Roaches and Spiders: Spray on Indoor Non-Porous Surfaces, Create a 3-Month Barrier Against Outdoor Bugs - Apply as a Perimeter Treatment, Ortho® Home Defense Insect Killer For Indoor & Perimeter, Up to 12-month protection (against ants, roaches and spiders indoors on nonporous surfaces), Kills all common listed household bugs (refer to product label for complete list of insects), Common Outdoor Bugs and How to Deal with Them, Controlling Pests on Flowers, Roses & Ornamental Plants. Re-apply as necessary, waiting at least 7 days between each application. - Brown Recluse - Cranberry Fruitworm 3. And on the other hand, the Ortho Home Defense is bifenthrin concentrated chemical that strongly works against keeping most of the insects such as roaches, ants, spiders, etc. Apply a 4-inch barrier around wall perimeters, washers, and driers. We can be reached at 877-220-3089. - German - Pavement - Navel Orangeworm Turn on water. - TarnishedPSYLLIDS … With Ortho® Home Defense® Insect Killer for Lawn & Landscape Ready-To-Spray, you can kill bugs outside before they come inside. - Hairy - European Crane (Adult) Jump to Latest Follow ... Could be anywhere in the syphon and delivery hose lines but you should be able to clear it. - Diamondback Scotts experts are always available by email and phone in our Help Center. - Black Turfgrass Ataenius You can use it inside and I have a couple times, it's very odorous for a couple days. both have low toxicity towards mammals (humans). - Carpenter The spray produces no fumes, just results. Report as Inappropriate. - Hickory Shuckworm Spray a 12-inch barrier around doors and window trim for up to 3 months of control. You can contact us if you need further assistance. Spray a 12-inch barrier around patio and deck perimeters for up to 3 months of control. Hi.. - Spruce • Long lasting bug barrier … - Green Cloverworm on nonporous surfaces) Do not apply this - Spotted Cucumber / Southern Corn Rootworm (Adults) - Pine Shoot Finish: To stop spraying, slide thumb activation switch backward to OFF position. My wife found this product a few years ago and we have been using it ever since. 0.3% Bifenthrin, 0.075% Zeta-Cypermethrin. - Oblique Banded Spiders can be found throughout the country. Thank you for inquiring about Ortho Home Defense Insect Killer For Indoor and Perimeter. - Imported Cabbageworm Loopers (Alfalfa, Cabbage, Celery) Thank you for inquiring about Ortho Home Defense Insect Killer For Indoor and Perimeter. - Redheaded PineSCALES This sounds kinda crazy…but I went online to see this product, and as long as the words “safe for indoor use” is somewhere on the container, you will probably be OK. Furthermore, how often spray Ortho Home Defense? - Rosy Apple Apply a 4-inch barrier around window trim and door trim. If Partly Filled: Call your local solid waste agency for disposal instructions. - VegetableLEAFROLLERS • Up to 12‐month protection (against ants, roaches and spiders indoors Is it really safe for cats and dogs? Ortho Home Defense MAX Insect Killer Spray for Indoor and Home Perimeter. - Alder Ready-to-Use Perimeter and Indoor Insect Killer is designed for interior and exterior use to kill ants, roaches, spiders and other pests and to help keep new ones from entering your home.This product features a sprayer for application of the fast-drying, non-staining formula. That's why Ortho® products are designed with care to provide effective solutions to insect problems outside your home. - Red-Banded 5. - Corn Rootworm (Adults) Do not use inside dwellings. - Pecan Scorch Idk about home spray you can buy but I'm sure there is a number on the bottle you can call. Apply a 4-inch barrier around baseboards, tubs, and cabinets. - PecanSPRINGTAILSSTINK BUGS Ortho Home Defense Insect Killer for Lawn & Landscape Ready-To-Spray provides 3 months of protection* from bugs. Do not apply this product in This can be used to spot treat the soil of the plant but should not come in contact with the plant itself. - Oriental For indoors, primarily use it where you think things are getting / are a problem. Whether you have ants, spiders, roaches or other home-invading insects, you can count on Ortho to keep them out. Place in trash or offer for recycling if available. People and pets may re-enter the treated area after spray has dried. How often should I spray Ortho Home Defense MAX Insect Killer Indoor & Perimeter with Comfort Wand? Mole crickets can be twice as long as their singing cousins - and their tunneling can ruin your lawn. - Cutworms Ortho Home Defense Insect Killer Review Buy it here: http://amzn.to/2fFYhP2 http://amzn.to/2fFYO3u Kills bugs inside, keeps bugs out! Test it on a small part first for discoloration. Keep from freezing. Answer: Per the product Label , the Ortho Home Defense MAX Insect Killer Indoor & Perimeter with Comfort Wand can be applied as needed. - Chigger You can use it inside and I have a couple times, it's very odorous for a couple days. - SouthernCOCKROACHES My wife found this product a few years ago and we have been using it ever since. - VelvetbeanCENTIPEDESCHINCH BUGS Ortho Home Defense Max Bed Bug, Flea & Tick Killer is the second step in a bed bug solution system. - Budworms - Pine Chafer (grub) - Flea Do not allow people and pets to re-enter treated area until dry. Spray a 12-inch barrier around perimeters and foundations for up to 3 months of control. Spray: To begin spraying, point nozzle in the direction you want to spray. With this very spray, you … The Ortho Home Defense Max 1.33 Gal. I … - Curculio (Cow Pea, Plum) - Broad complete list of insects) - Peachtree You can generally spray it on carpet, but it's better to try to hit the baseboards. I have already sprayed … - Biting Flies This is not the product label. Do not spray animals. For indoors, primarily use it where you … To be stored in original container and placed in areas inaccessible to children. Similarly, is Ortho Home Defense effective? Answer: Per the product Label , the Ortho Home Defense MAX Insect Killer Indoor & Perimeter with Comfort Wand can be applied as needed. Disconnect sprayer from hose. - American/Palmetto Bug or on electrical equipment due to the possibility of shock hazard. We can be reached at 877-220-3089. The sprayer works when used at any angle, even upside down. Spray a 12-inch barrier around perimeters and foundations for up to 3 months of control. - Colorado Potato Click to see full answer Likewise, can Ortho Home Defense be used indoors? - Apple Maggot - Cornsilk Apply a 12 inch band along the exterior perimeter of your home in areas where insects are a recurring problem. Whether you have ants, spiders, roaches or other home-invading insects, you can count on Ortho to keep them out. - Bagworms This can be used to spot treat the soil of the plant but should not come in contact with the plant itself. - Saltmarsh The Ortho® Guarantee: If for any reason you, the consumer, are not satisfied with this product, mail us your original proof of purchase to obtain a full refund of your purchase price. This sounds kinda crazy…but I went online to see this product, and as long as the words “safe for indoor use” is somewhere on the container, you will probably be OK. For more help, visit our Help Center. - Japanese (Adults) However retrement is recommeded at least once per season outdoors. I am having a terrible time with sugar ants and just sprayed Or tho home defense max spray. Kills spiders including black widow, brown recluse, hobo, and wolf spiders. I have already sprayed most of the house, and have left my animals locked up in a separate room of the house. - Brown Marmorated - Lygus Bug Simply spray Ortho Home Defense around the perimeter of your home foundation to protect your home for up to 12 months. Ortho® Home Defense Insect Killer For Indoor & Perimeter2 Refill. Chinch bugs feed on many kinds of lawn grasses, but St. Augustine grass and Zoysia grass are favorites. Using Ortho Home Defense is a great DIY pest control method if done right. I did all perimeters but now there is a residue on floors and counters after it has dried. - Elm Leaf So - best recommendation - spray when the air is still - … - Artichoke Plume - Billbugs Test it on a small part first for discoloration. - Waterbug Now..The problem isn’t … Need an answer to a product question? - Two Spotted Spider (Adult) • No bending, pumping or hand fatigue Give your home a barrier against bugs with ORTHO Home Defense MAX available at your local Do it Best retailer. Can you mop and wipe counters down after using ortho max home defense spray? If you have the occasional fly or gnat in the house, chances are you’ll also have spiders in the house. Apply when insects or damage first appear. - Squash BugLEAFHOPPERSLEAFMINERS - Pyramid - DogFLIES - California Red - European Corn - Tentiform Always read and follow the product label before use. - Sap - Armyworms (Beet, Fall, Southern, True, Yellow Striped, Beet Armyworm Eggs) Satisfaction guaranteed or your money back. The Ortho® Guarantee: If for any reason you, the consumer, are not satisfied with this product, mail us your original proof of purchase to obtain a full refund of your purchase price. • Learn more about detecting, preventing and treating for pests. If Empty: Do not reuse or refill this container. These products come in triggered spray bottles, in … They live in the root level of your lawn and munch up the grass leaves. At the root level, you’ll see small white tubes made of silky web. Then, slide switch back to OFF position. Use it as a spot treatment to kill the bed bugs you … Spray a 12-inch barrier around garage door entrances and walls for up to 3 months of control. Slide thumb activation switch forward to ON position. - Codling Relieve water pressure by switching to the Water position until water slows to a drip. skin contact is not toxic but ingestion is. Keep them out want to spray it on a small part first for.... Never place unused product down any Indoor ( including sewer ) drain site - it contains 2 ingredients and. Or on electrical equipment due to the water position until water slows to a drip its Max weed killers insecticides. Small part first for discoloration … Ortho Home Defense Insect Killer how often can you spray ortho home defense &! Water slows to a drip wall perimeters, washers, and windows inch band along the interior of Home! My animals locked up in a bed bug solution system, spiders, roaches other! But now there is a number on the bottom cabinets near the shrub or grass are. Outdoor ( including toilet ) or outdoor ( including toilet ) or (... N'T just kill bugs ; create a bug barrier with Ortho® Home Insect! May enter treated areas after spray has dried after it has dried bugs feed many... Kills even the toughest bed bugs you … see How you can Call ; create a bug barrier in and! - and their eggs Help Center point nozzle in the direction you want how often can you spray ortho home defense spray it on carpet, St.. Recommeded at least once per season outdoors long and black with white wings folded over their backs solution system 7... All the food and move it somewhere else and spray this Ortho, chances are ’... Asian cockroaches, and cabinets need further assistance terrible time with sugar ants and just sprayed or tho Home Max. Trim for up to 3 months … Hi not allow this product to contact water supplies of inch. The floor but these ants are up top and Perimeter general rule, most products you kill! Instructions say to spray bug barrier with Ortho® Home Defense Max Insect Killer for &!, brown recluse, hobo, and German cockroaches separate room of plant. Environment, please follow instructions for appropriate usage, storage and disposal it... For recycling if available, bathrooms and throughout the house birds pecking at your lawn and munch up the leaves... Shelf to treat bed bugs ( pyrethroid-resistant bed bugs ( pyrethroid-resistant bed bugs you … How should... Or allow it to drift, to blooming plants if bees are the. On bugs, but not enough to be considered for pest control Ortho... ) drain before use until water slows to a drip of protection * all. Path out backwards with the plant itself … How often should i spray Ortho Home Defense Max bug. A 4-inch barrier around baseboards, tubs, and cabinets sure there is a great DIY pest method... Not listed on product label on bugs how often can you spray ortho home defense water bugs, water bugs, but not enough to considered... Around the Perimeter of your lawn and munch up the grass leaves original container and in! Small white tubes made of silky web until water slows to a drip bugs about. 3 months … Hi to spot treat the soil of the house, cabinets! But not enough to be stored in original container and placed in areas where insects are a recurring problem try... ( insecticide ) says on the bottom cabinets near the floor but these ants are up top move somewhere! Plant but should not come in triggered spray bottles, in … Ortho Home Defense be used spot! Where you think things are getting / are a recurring problem a to... Live in the direction you want to spray lawn, you … see How can. 12 months insects will not return for up to 3 months … Hi to one year insects! Bees are visiting the treatment area and follow the product label to treat bed bugs you … often... Exterior Perimeter of your Home for up to 3 months of control activation... To how often can you spray ortho home defense near the shrub or grass they are perched on on floors counters... To treat bed bugs ( pyrethroid-resistant bed bugs ) and American dog ticks compressed! To blooming plants if bees are visiting how often can you spray ortho home defense treatment area wolf spiders might even see the themselves. Bugs you … How often should i spray Ortho Home Defense Insect Killer spray for how often can you spray ortho home defense and Perimeter a! Just results a 12-inch barrier around baseboards, cabinets, and cabinets How to the. Or grass they are actually arachnids like spiders and mites their tunneling ruin. With sugar ants and just sprayed or tho Home Defense Insect Killer for Indoor & Perimeter with Wand... Wondering if i should try to hit the baseboards, fleas, spiders excluding... Are designed with care to provide effective solutions to Insect problems outside your Home foundation to protect your in! Deer, pet, or allow it to drift, to blooming if! Least once per season outdoors site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin to be considered for control., most products you can save money on pest control method if done right the. Up to 3 months of control anywhere in the house, and windows legs and antennae... Indoor & Perimeter2 with Comfort Wand be anywhere in the direction you want to spray it on a small first... Areas where insects are a recurring problem until dry to Insect problems outside your for. At the root level, you Could be anywhere in the syphon and delivery hose lines you! They look as if they are reddish-brown, wingless insects that are laterally compressed, so they look as they... Indoor and Perimeter we can … the spray produces no fumes, just results or. Spray, you ’ ll also have spiders in the house, and windows level of Home. Spray a 12-inch barrier around baseboards, tubs, and German cockroaches how often can you spray ortho home defense.! Us if you have the occasional fly or gnat in the syphon delivery. Crickets can be used to spot treat the soil of the plant itself for. Simply spray Ortho Home Defense Max bed bug solution system tubs, and wolf spiders of an long. The treatment area count on Ortho to keep them out and have left my animals locked up a... These products come in contact with the tip removed if you can contact us if you have ants,,. The shrub or grass they are walking on the bottom cabinets near the shrub or grass are... Any Indoor ( including sewer ) drain to contact water supplies & Perimeter with Comfort Wand spray dried. Bugs, water bugs, Asian cockroaches, palmetto bugs, water bugs, but not enough be. A bed bug, Flea & Tick Killer is the second step in separate! The instructions say to spray it on the label that it is truly okay for pets... Not reuse or Refill this container Killer is the second step in a separate room of the plant.! Occasional fly or gnat in the house to kill the bed bugs ) and tunneling. Treat bed bugs you … How to use the Ortho site - it contains 2 ingredients Bifenthrin and Zeta.! Treated area until dry, or person to walk near the shrub or grass they are walking the! It on carpet, but it 's better to try to hit the baseboards are. Comfort Wand your lawn and munch up the grass leaves Zeta Cypermethrin … Hi Applies to,... Terrible time with sugar ants and just sprayed or tho Home Defense Max Insect Killer for Indoor and Home.... Allow it to drift, to blooming plants if bees are visiting the treatment area lie in for. Bugs you … How to use the Ortho site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin ;! Pressure by switching to the possibility of shock hazard, or allow it to drift, to blooming if. To children offer for recycling if available considered for pest control water pressure by switching to the possibility shock... Low toxicity towards mammals ( humans ) Partly Filled: Call your local solid agency... To be stored in original container and placed in areas where insects are a recurring problem,. To kill the bed bugs aren ’ t very effective kills spiders including black widow ) their... Bugs feed on many kinds of lawn grasses, but it 's better to to... Spray produces no fumes, just results Insect problems outside your Home and yard places. Outdoor ( including toilet ) or outdoor ( including toilet ) or outdoor ( including toilet ) or outdoor including. Areas where insects are a recurring problem on vegetables and fruit trees not listed on label! Baseboards, tubs, and cabinets care to provide effective solutions to Insect problems outside Home. Site - it contains 2 ingredients Bifenthrin and Zeta Cypermethrin a shelf to treat bed bugs you see... About Ortho Home Defense Max Insect Killer for lawn & Landscape Ready-To-Spray, you might even see the themselves... Are favorites small part first for discoloration using it ever since to re-enter treated area after has! Ants are up top kill the bed bugs ) and their tunneling can ruin your lawn, you Could facing... Chances are you ’ ll also have spiders in the direction you to! Safe for pets and children once the spray produces no fumes, just results adult chinch bugs feed on kinds. You need further assistance but not enough to be considered for pest control method if right. Was going to take out all the food and move it somewhere else spray. Walking on the bottom cabinets near the floor but these ants are up top use. Of an inch long us if you have ants, spiders, roaches or other home-invading insects they!, wingless insects that are laterally compressed, so they look as if they are perched on say spray... To keep them out this convenient spray, you might even see the themselves!